Wilbert Fernandes

Prayer Warrior
Prayer request for ### blood pressure, sugar, and protein level in the urine to be alright. ### admitted in hospital bcos of this problem, please pray for health and safety of ### and baby child.
 
Praying with and for you in Jesus.

We can do everything Jesus did and more! We can speak; sickness leave in Jesus! Be healed by Jesus stripes! I am healed by Jesus stripes! Amen! Thank You Lord Jesus!

You can copy and paste this to pray every day and share...

There is nothing that happens for us that is bad. All things work for our good in Jesus! Look at everything as good!

Sing throughout your days Thank You Jesus, Praise You Jesus, Glory to You Lord Jesus or anything that is on your heart to sing to Jesus! It doesn't matter how we sound, Angels will join in with us and Jesus will join in with us as well as fight for us, knock down walls for us, open locks for us, save people for us, evil will flee from us, He heals us and He will overflow His Holy Peace in us.

Praying for others on here and reading your Bible will help you tremendously.

I wanted to commit suicide once, I even came up with a plan. Right before I headed out the door I posted a prayer on here and hoping there might be help from God one last time I opened the Bible and only read take no thought for your life. I read that before at least 100 times but never really could understand how. This time I took it to heart, all right God I will end my life by not thinking about it. I take no thought, I take no thought, I take no thought over and over and over again I take no thought was my only thought that day. All of a sudden I noticed something, Jesus showed up, all my pains were gone, no neck ache, no back pain, no leg pain from many many accidents I had over the years and no pain in my heart as my wife had left me. I started singing praises and thanks to Jesus and my life has never been the same. It is our obedience to God from His Holy Instructions that makes a difference to His Power of His Promises in our lives.

Be a doer of Jesus friend, it really makes a difference! Thank You Lord Jesus!

Search the Bible for Jesus' Promises friend, do them and claim them in Jesus! Amen! Thank You Lord Jesus!

Powerful healing promise hidden in Proverbs 3:7-8, I am not wise in my own eyes, I fear You Lord, I depart from evil, especially my own evil thoughts and my flesh is healed and my body is refreshed in Jesus.

Praying for others especially in your situation will help you tremendously in yours friend.

Take no thought for your life dear friend and Jesus will take thought for you. Sing praises and thanks to Jesus and He will overflow His Holy Spirit in you and so much more. He will fight for you and give you the desires of your heart.

Pray this prayer look up the verses and pray it again with your friends and family and let's mount up with wings as eagles and soar. Soar with me.

Let Us Pray: God I ask in Jesus' name, bless me to grow closer to You. I long for a more intimate relationship with You. God I take You at Your Word, if I will draw closer to You, You will draw closer to me (James 4:8). Show me how to draw closer to You. Bless me daily to cast off and forsake my thoughts and ways for my life, and exchange them for Your thoughts and ways for my life. Let me think Your thoughts and dream Your dreams for my life. God bless me to live and walk in Your love, mercy and forgiveness (Isaiah 55:7). I confess, I will take no thought for my life. I will trust You Father God to take thought for me and take care of me (Matthew 6:25-34). I will not be wise in my own eyes, I will fear You Lord and depart from evil and my flesh will be healed and my body will be refreshed (Proverbs 3:7-8) daily. Thank You Jesus for Your Promises! Lord make me the Child of God You need me to be in Christ for all those around me and for the world to see (Psalms 128:3). Not by my might, nor by my power, but by Your Spirit Christ Jesus (Zechariah 4:6) this shall happen. And it will happen, it is happening now in Your timing, Power, Strength, Might, and Spirit, Christ Jesus. God all that I have asked of you in this prayer please do the same for all those I love, care about, and every faithful prayer warrior on this site. Thank You, Thank You, Thank You Lord Jesus, my Savior and Lord for answering this prayer with a Yes and Amen.

Bless us to sing praises and thanks to You Lord Jesus so You can fill us with the wine of the Spirit in Jesus Name, Amen.
 
Matthew 8:7
“And Jesus saith unto him, I will come and heal him.” -King James Version (KJV)


Be assured my friend for we have a God who blesses. I prayed on ###'s behalf and I asked our Heavenly Father to bless her with all of her needs. I pray through the grace of our mighty God that He will fully restore ###'s health and deliver her from all discomfort, in the name of our risen Saviour Jesus. Amen.
 
Prayer request for ### blood pressure sugar and Protein level in the urine to be alright. ### admitted in hospital bcos of this problem, please pray for health and safety of ### and baby child
Prayed. The answer is on the way. I encourage you to follow the Word Of God in totality in order for Him to bless you and grant your desires.

The Bible lays down in

John 15:7 If you abide in Me, and My words abide in you, you will ask what you desire, and it shall be done for you.

___________________________________________________________________________________________________________
 
I have prayed in Jesus' name that God will hear and grant your prayer request according to God's perfect love, wisdom, will, timing, grace, and mercy. Amen!

Let Us Pray: God I ask You in Jesus' name protect all those I love, care about, the writer of this prayer, and myself from Covid-19. God teach us Your Word so that we may know You, love You, obey You, and make You known. Bless each of us to prosper, walk in excellent health, and cause our souls to prosper in Your Word, Your ways, and never cease to grow in the grace and knowledge of Christ Jesus. Bless us with the love, desire, strength, wisdom, and the spirit of obedience to always obey Your Word and Your will for each of our lives. Bless us to live our lives for Your glory, approval, and applause. Let every desire we have line up to the purpose You created each of us for. God, You become our greatest delight and Your Word our greatest treasure. Bless each of us to have, and always seek to have an ever-growing-closer-stronger-intimate-relationship with You. Bless us all to have a God solution-focused heart, mind, spirit, and attitude. Give each of us a praying spirit. Bless us to always pray and never panic, faint, or worry. Bless us to always keep our focus on You and walk in the love, peace, security, and wisdom of Your Word. Bless us to walk by faith and not by sight. Bless us to trust You, believe in Your Word, and trust in Your love for us. May we each daily have a heart of thanksgiving and gratitude for who You are and all that You have done and will do in our lives. God cover us. Cover us in the prayers of the righteous. Encamp Your angels all around us, and give them orders to protect us from all sicknesses, viruses, evil, accidents, hurt, harm, danger, the plans of our enemies, and the plans of the enemy of our souls. God forever honor this prayer over each of our lives. Thank You Jesus. Amen, so be it by faith, and by faith, it is so.


Click on the links below and pray the Family Prayer
 

Similar Requests

alsopraisereort:thankyouLordwhileinprayerifelthealigninmyteethjaws.pleasehealallwhohaveinfecitonandhaveteethandgumandbonediseasedentalandmetasbokcidiseasesdiabetesandsadness.pelasehalme and others form this. helamy grndma sblood sugar blood pressure. hel my brother and hsi...
Replies
11
Views
48
Praying for dad’s blood pressure to normalize, his blood pressure has been all time high 230/180 never has been this high, they say it’s life threatening to have it this high he has no health insurance, he’s feeling dizzy and blurry vision, please pray for this, also pray for him to get health...
Replies
8
Views
56
I don't know how to cause to get high blood pressure in both my legs when I woke up this morning. Please get rid of high blood pressure in my body. High blood pressure must have to leave my body in the name of Jesus Christ, Amen.
Replies
7
Views
68
Your donations for running this web site are greatly appreciated.

Click To Make A Donation

Forum statistics

Threads
2,014,757
Messages
16,059,993
Members
569,746
Latest member
Taoview

Latest Blogs & Articles

Back
Top Bottom